PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn013951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family B3
Protein Properties Length: 352aa    MW: 40663.8 Da    PI: 9.9585
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn013951genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.64.7e-138811598
                -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
          B3 15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                 l +p +f+ ++ ++ e++ + +l++ +  +W+vk+  ++++   + ++GW +F+k +gL+ gDf+vF+++g++ f   v+vf+
  Achn013951  8 TLLIPISFF-KYLNV-ENPNQAVLRT-HCGEWQVKI--NNGQ---LSQDGWTDFAKRHGLQKGDFLVFRHEGDMVF--DVMVFD 81
                578999999.67333.3444566555.8899*****..7776...789***********************99999..888887 PP

2B366.63.5e-21142231395
                 EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
          B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                 + ++++++++  r+ +p  fa++hg+ +++  +++++d +grsW+v+l+++ ++g+++++ GW++F  an Lk+gD++ F+l+++ ++++ + 
  Achn013951 142 S-TLKPYSFTGYRINIPMGFARRHGLCNRCC-EMIIKDDEGRSWKVRLRHKSSDGKVYIGHGWRRFQLANALKVGDVFSFELIDH-GTKPIMV 231
                 4.4489999999************9997775.9***************99999999**************************984.4444444 PP

3B350.14.9e-16263339887
                 -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
          B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgr 87 
                 + ++k + l++pk+fa+ +g+ k   k++tl+d++ r+W ++l  rk+s++  ++++GWke + an+L++g ++ ++l++ 
  Achn013951 263 PFNFKWSELYIPKDFARLNGLGK--YKKMTLKDPEKREWVLYL--RKTSNQrLYIGQGWKELAAANDLQVGHVIKLELIKA 339
                 45666678***********9885..558***************..7777777*************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.266183IPR003340B3 DNA binding domain
SMARTSM010197.4E-6583IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-16790IPR015300DNA-binding pseudobarrel domain
PfamPF023622.8E-9879IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-15985IPR015300DNA-binding pseudobarrel domain
CDDcd100179.66E-13981No hitNo description
Gene3DG3DSA:2.40.330.101.7E-23135235IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-24137236IPR015300DNA-binding pseudobarrel domain
CDDcd100178.09E-25138234No hitNo description
SMARTSM010199.0E-21139236IPR003340B3 DNA binding domain
PROSITE profilePS5086314.988139235IPR003340B3 DNA binding domain
PfamPF023629.7E-20140234IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18254341IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-18255342IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.816256351IPR003340B3 DNA binding domain
CDDcd100175.67E-16257347No hitNo description
SMARTSM010192.0E-16257351IPR003340B3 DNA binding domain
PfamPF023626.7E-15261343IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSYPYHITLL IPISFFKYLN VENPNQAVLR THCGEWQVKI NNGQLSQDGW TDFAKRHGLQ  60
KGDFLVFRHE GDMVFDVMVF DPSACEREYP PRNLERNPVG SREEKESSQS KSMNDLCQDQ  120
MDKNSVKGEA SNSTFSHPYF VSTLKPYSFT GYRINIPMGF ARRHGLCNRC CEMIIKDDEG  180
RSWKVRLRHK SSDGKVYIGH GWRRFQLANA LKVGDVFSFE LIDHGTKPIM VFHRSSKTKM  240
VHPEEKKMPG KFTPKDFMAT LTPFNFKWSE LYIPKDFARL NGLGKYKKMT LKDPEKREWV  300
LYLRKTSNQR LYIGQGWKEL AAANDLQVGH VIKLELIKAG NTLAMKLSFQ G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.17e-51B3 family protein